PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.151
Common NameAMTR_s00048p00192390, LOC18443923
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 215aa    MW: 23817 Da    PI: 9.9168
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.151genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-333084155
                                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                              kprlrWtp+LHe+Fv+av++LGG+ekAtPk++l++m+ kgLtl+h+kSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00048.151 30 KPRLRWTPDLHECFVDAVTKLGGPEKATPKSVLKVMGFKGLTLYHLKSHLQKYRL 84
                                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-322785IPR009057Homeodomain-like
PROSITE profilePS5129413.4512787IPR017930Myb domain
SuperFamilySSF466895.73E-163085IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-243085IPR006447Myb domain, plants
PfamPF002492.5E-93283IPR001005SANT/Myb domain
PfamPF143791.4E-21124170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MFNSGSGEQS GANGAGNLSE RDAMLSRDPK PRLRWTPDLH ECFVDAVTKL GGPEKATPKS  60
VLKVMGFKGL TLYHLKSHLQ KYRLGKQPRR ESSTEGGKDG SLGSQKPPIL ATDSALRQNN  120
QGEIQIAQAI RYQIEVQRKL QEQLEVQKKL QMRIEAQGKY LQAILEKAQQ SLRCKEGVEE  180
ESKVGSDYQK TAAGSLDLNV NQGSLDLQIY KRYS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854165.11e-157PREDICTED: myb family transcription factor APL
SwissprotQ9SAK55e-54APL_ARATH; Myb family transcription factor APL
TrEMBLU5D2K71e-157U5D2K7_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr11P06340_0015e-68(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-48G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]